SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13894
Domain Number 1 Region: 8-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.99e-18
Family GntR-like transcriptional regulators 0.017
Further Details:      
 
Domain Number 2 Region: 82-213
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000549
Family GntR ligand-binding domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13894
Sequence length 231
Comment (Caenorhabditis remanei)
Sequence
MHSEEVDSLSEQIAKHISEQIISGELVEGERIQELRIAKELDVSRGSVREALLLLERTHL
IEIYPRRGAIVSEMSAQQVRALFDTSALLLGQIVQRMSETWRNHEAEAIQQMMNHLVEQV
KQGNTEKFYDGIFQFLSGQQDMVGNPYLMKFYKELLPSLRRSYFLTLNTSRRELQEALEL
LKLVIDAILIRKSQQATLFMEDFCRHLRNLVLESLTRMKQIELAWARRSRR
Download sequence
Identical sequences A0A072CUM8 A0A077L2R9 A0A0Q7FBH9 E3NX56 N8TF85 N8X2V0
WP_004724049.1.15248 WP_004724049.1.19192 WP_004724049.1.22718 WP_004724049.1.25018 WP_004724049.1.53393 WP_004724049.1.55951 XP_003087016.1.11157 CRE13894 31234.CRE13894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]