SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE16749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE16749
Domain Number 1 Region: 258-471
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-50
Family DBL homology domain (DH-domain) 0.0000486
Further Details:      
 
Domain Number 2 Region: 842-940
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-26
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 3 Region: 37-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-23
Family Calponin-homology domain, CH-domain 0.0069
Further Details:      
 
Domain Number 4 Region: 938-1006
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 476-612
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000225
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 633-676
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.021
Further Details:      
 
Domain Number 7 Region: 696-778
Classification Level Classification E-value
Superfamily SH3-domain 0.000000144
Family SH3-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE16749
Sequence length 1020
Comment (Caenorhabditis remanei)
Sequence
MPRRGTTSSNFGLSWSLVDVLSSTTAVVQVPMSSGSELWIGCARWLRDLNVLTTDKNGTI
VEFASILRDGILLCRLANTLVPNAINQNDIIKAQQQTQVIIMMYFILIQCILQFTCTRNI
RLFVNFCKSHFKLQDSDLFNPEKLYHMDGFQQILKTLSILSHTDESIRRGVNPFPETTTN
QESSSCSPCLDFNDDEDIYQSLPKDIDSVNPDETIYGPITSAEEKQNEQVYDRIVTNRKP
SMNENDLKTSSSNIKDLRVKELYDTEVNYVRSALGQLIDIFYKPLKEIISTEQFKTVFAN
IEPIHKFHVSLLADLEYPVNFTWGVSEEKVPRPTTLNGIEAPRTIGEVFVKYRDQFLIYG
KYCSNLLDSREMINSLLNTNEKFAKLVNESAQQAGCKFSLNDLLCVPFQRITKYPLLLKE
LLKKCDMSSPDRKSLAEAVEVMEDVCNYINEESRDTTSKKMIDEIEKSIVDLAMPENVKL
HDYGRVNFDGEVKMSESTATTYGKAKQRYVFLFDKVIVVCKTMTKMPVKEKSPSGSNLKS
NTFTYKNAYIMSELNIDQNVSIDTKSGGTITRRTQYVIHMHRDRNEGSEITQISFYFKNE
ATRSAWMTALLLSKSNVSPTEYLRDTNHKVSFHSLRVDLEKPYTCGVCEKLMKGLRYQGY
KCESCEMIMHKDCLGLKKCEAIRRSTHEHRSSHSFNISRPRLTVREGDVVTASSTVIPQD
LSYLQFTKGDTIEVIKMQSHNRFTGCVSNNRNRTGLVHLDHISKPRTTSMIGLSPMESPA
GSIVRIGRHESTVLPNKPLSDPSARSSDPQLSRTSRTSSTSTVNGNNENGRPQEYVNTEI
AGFRWYMGEMERTKAESTLRGTPNGTFLVRYSKNRKQTAISLSYKNDVKHMIIEKNQDGK
MYLDEDYIFNSTVELVQYYRDHNLIEIFQALDTCLKVPYSACKVYKAVHDYDPPSPNSDG
KFLSFKTGDTVVLLDTVGEDRGWWKGQVNNKTGFFPLSYVKALESISDDNGPSTPTSSSS
Download sequence
Identical sequences E3MAT6
31234.CRE16749 XP_003106740.1.11157 CRE16749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]