SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE26958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE26958
Domain Number 1 Region: 80-331
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-86
Family Calponin-homology domain, CH-domain 0.00000423
Further Details:      
 
Domain Number 2 Region: 350-471
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-32
Family Spectrin repeat 0.0000642
Further Details:      
 
Domain Number 3 Region: 2186-2297
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-29
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 4 Region: 1070-1225
Classification Level Classification E-value
Superfamily Spectrin repeat 5.35e-27
Family Spectrin repeat 0.0000227
Further Details:      
 
Domain Number 5 Region: 1282-1435
Classification Level Classification E-value
Superfamily Spectrin repeat 6.79e-27
Family Spectrin repeat 0.00048
Further Details:      
 
Domain Number 6 Region: 1940-2073
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1599-1738
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-26
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1495-1648
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-25
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 9 Region: 663-799
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-24
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 10 Region: 876-1011
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-24
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 481-580
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-22
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 12 Region: 1751-1870
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-21
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 13 Region: 804-907
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-17
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 14 Region: 585-695
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-16
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 15 Region: 1866-1968
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-16
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 16 Region: 2077-2146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000017
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE26958
Sequence length 2342
Comment (Caenorhabditis remanei)
Sequence
MSSVDDENHPAVEIDLPDEYESASDCEQAHECNYLGDILKAKKSLKKIRESVSPGVYPGS
AGALSSLSERHVDENKAPVSAEVFDSLCGRKTVNSIDLRFRGLRDEREFVQKKTFTKWVN
SHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRN
QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQM
KTAGYPNVNVKNFSTSWRDGLAFNALIHKHRSDLVDYDNLQKSNALYNLQSAFDTAENQL
GLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMIN
RYETLSSDLLEWIHAKIQLLNDRHFENNLDGVQKQLTEFNDYRTQEKPPKFDEKGELEVL
LFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELALKEELIRQEKLEQLAA
RFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVA
GELEAENYHDQAKINERKENVLKLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMD
DIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQSQRFRNEEGPDGSGY
KPVEPGTIDERCDTLQQRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVL
SSNDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDENIPGSDNIPPRLAE
IRDYINKLKELSKARKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQL
LLKKHDDVTDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLRQKAELENLAQLR
KQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQ
EAKVANVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFR
IDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADD
IERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTAT
QRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLR
QRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDVPQSL
EQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANR
EKAQDVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQS
ELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANR
QQLYVQSIADMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLME
MEPQLEELHPEELENIRAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLW
ISERLALARAQNLGESLPDCHRLQKNLNLLSSEIDNHEPWINQICNNGQELIDEGHANGP
AFEKKIQELRSAWQELKDAVQDRKKDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERG
KDEFSTKNQIKKHERLQADIDKFADTIRALANKAHKFVEENSPLTEQITVRQAQIEKLYA
GLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQ
QFARDTENIGSERVANANDGCDSLIAHGHTDAPTIALWKDSLNEAWENLLELMDTRAQIL
EASRLLHKFYHDCRDCLSRIMEKTHAMPEDLGRDSSSVGALSRKHQNYLKDIAAIGEQVA
QIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVR
DLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRK
HYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLI
SREYGRNLEETIKLIKKHEAFEKSALAQEERFLALEKLTTFELKESQHREEEASKRRGPA
HIGSPSRSTPAAETSFGAQDDGAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQ
NELAFYKDPKHREESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPVGAEYLLQCGSDE
DMQRWLTELQVATGQAQLEEASRSQTLPGMILNLGFSQKQITILAEGSATKKKGGFFSRS
KK
Download sequence
Identical sequences E3LPH0
31234.CRE26958 XP_003114296.1.11157 CRE26958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]