SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314565.XC_1290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314565.XC_1290
Domain Number 1 Region: 10-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.45e-50
Family Methylesterase CheB, C-terminal domain 0.0000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 314565.XC_1290
Sequence length 343
Comment (Xanthomonas campestris 8004)
Sequence
MVDNDLHPQQHRDVIVIGGSAGAGEALRRLLGALPAQTPAAILVVLHMSAHGHGIMRTVS
AGANGITVVEAADGMRIEPHTLYVAVADRHLMVADGRIVLGTGPRENMSRPSIDALFRSA
AVAFGPRTVGVLLSGMLNDGTAGLDAIHACGGTVLVQDPGEAVASDMPLSALQRVPADAV
RSSAELGGLIAELAQTAAGPARVITDALRLEVAIARGALTTTDDTARIATPVAMSCPACG
GVLSQISESSVLRFRCQVGHAYTGESLLSATEGSVDEALRIALRIIDERATLVARMADSN
TRAQPNTAAMYRHRADEYRGYADTLRKALLRKSPLAAAVEPSE
Download sequence
Identical sequences gi|77761145|ref|YP_242379.2| 190485.XCC2822 314565.XC_1290 gi|77747904|ref|NP_638170.2| NP_638170.2.47755 WP_011037947.1.12496 WP_011037947.1.1732 WP_011037947.1.27778 WP_011037947.1.31612 WP_011037947.1.40219 WP_011037947.1.475 WP_011037947.1.56666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]