SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 314565.XC_2163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  314565.XC_2163
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.54e-49
Family Methylesterase CheB, C-terminal domain 0.0000912
Further Details:      
 
Weak hits

Sequence:  314565.XC_2163
Domain Number - Region: 229-257
Classification Level Classification E-value
Superfamily YfgJ-like 0.0562
Family YfgJ-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 314565.XC_2163
Sequence length 350
Comment (Xanthomonas campestris 8004)
Sequence
MTIENNRNIVAIGGSAGASQALRTLLADLPRDLPAAVLVVLHLSPQGTGIVEMVRSAVRG
LPVYVASDGVPLVPGAVYVAVPDSHLMVDGMHVVLGRGPRENMSRPSIDALFRSVAVSHG
ARALGVLLSGMLNDGCAGLEAIQACGGAVAVQDPDDAIADDMPRNALRALTPDVVAPSAA
LGAVITDLVREPAAWPIAPSDALKLEVAIARGQPSTTEVMTQLGEPVALSCPACGGVLTK
LHTPGTLRFRCQVGHGYTAPALMSAKEGSVDEALRVALRVIEERAELVSRMAGDDRVHQP
SVASLYAARAKEYRGYADVLRSALLTSLQRPVEHGALVEDGALLTQEDQH
Download sequence
Identical sequences A0A0H2X7L4 B0RT90
314565.XC_2163 509169.xccb100_2321 gi|66768477|ref|YP_243239.1| WP_011269772.1.10627 WP_011269772.1.12496 WP_011269772.1.1732 WP_011269772.1.18295 WP_011269772.1.22538 WP_011269772.1.27778 WP_011269772.1.31612 WP_011269772.1.36111 WP_011269772.1.40219 WP_011269772.1.4502 WP_011269772.1.475 WP_011269772.1.56666 WP_011269772.1.82601 gi|188991715|ref|YP_001903725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]