SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_0468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_0468
Domain Number 1 Region: 855-964
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.8e-31
Family Collagen-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 733-850
Classification Level Classification E-value
Superfamily PKD domain 1.96e-18
Family PKD domain 0.0012
Further Details:      
 
Weak hits

Sequence:  315730.BcerKBAB4_0468
Domain Number - Region: 620-676
Classification Level Classification E-value
Superfamily Bacteriocin immunity protein-like 0.0889
Family Carnobacteriocin B2 immunity protein 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_0468
Sequence length 965
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MNKQSKINKVLLSISTMALSLGAIQTNVSAEEKVPYNVLHSKPVGIEKPVDEIGHASKAE
ETLSFQERLKVGDFSQRPASITKNSAVKQAKEGYSMADLNKMNDQELIETLGSIKWHQIT
DLFQFNEDAKAFYKDNGKMQVIIDELAHRGSTFTKDDSKGIQTFTEVLRSAFYLAFYNNE
LSDLNERSFQDKCLPALKAIAKNPNFKLGTNEQDTVVSAYGKLISNASSDVETVQYASDI
LKQYNDNFNAYVDDRMKGQAVYDMMQGIDYDIQSYLNEARKEANETMWYGKVDGFINEIN
RIALLNQVTPENKWLVNNGIYFASRLGKFHSNPNKGLEVVTQAMHMYPRLSEPYFVAVEQ
ITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGSIVFKTGDKVSEEKIKRLYWAA
KEVKAQYHRVIGNDKALEQGNADDVLTIVIYNTPDEYQLNRQLYGYETNNGGIYIEETGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGRGDMYQNERLTWFQEGNAEFFA
GSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKYGSWDFYNYSFALQSYLYTHQFETF
DKIQDLIRANDVGNYDTYRETLSKDSKLNKEYQEYMQQLIDNQDKYNVPEVADDYLAEHA
PKALTEVKKEISETLSMKDTKMTKHTSQFFNTFTLEGTFTGSVTKGESEDWKAMSKRVNE
ALEQLTQKEWSGYKTVTAYFVNYRVNSSNEFEYDVVFHGIAKDDRENKAPTVNVNGPYNG
FVKEGIQFKSDGSKDEDGKIVSYLWDFGDGRTSKEVNPVHAYEREGTYKVALVVKDDKGK
ESRSETTVTIKDGSVTESEPNNRPEEANRIGLNTTIKGSLIGGDHTDVYTFNVASAKDID
ISVLNEYGIGMTWVLHHESDMQNYAAYGQANGNHIEAKFNAKPGKYYLYVYKYDNGDGTY
ALSVK
Download sequence
Identical sequences A9VTN8 J8D4H9
gi|163938478|ref|YP_001643362.1| 315730.BcerKBAB4_0468 WP_002140307.1.85012 WP_002140307.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]