SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315730.BcerKBAB4_3229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315730.BcerKBAB4_3229
Domain Number 1 Region: 863-970
Classification Level Classification E-value
Superfamily Collagen-binding domain 8.37e-29
Family Collagen-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 771-856
Classification Level Classification E-value
Superfamily PKD domain 8.89e-23
Family PKD domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 315730.BcerKBAB4_3229
Sequence length 971
Comment (Bacillus weihenstephanensis KBAB4)
Sequence
MKGYSKKVLVGVSFASLMLGSFQGSILAEDTKGEQVSYRNVLKMEPVGVQLPVEELAHSS
KVLESKSFEKRLQFADLSQRPPEVKKESKQLAVAKTYTIAELNQLSNQQLVDLLVTIDWE
QITGLFQFNKDSLAFYQNDSRMQAIIDKLKQQGQAYTKDDSKGVETLVEVLRSGFYLGFY
NAELSKLNERSYHDKCLPALKTIANNPNFKLGTLEQNRVVSSYGKLIGNASSDVETVTSA
AKIFKQYNDNFSTLVDNLSAGNAIYDIMQGVDYDIQSYLYDTRKVPKDTVWYQKIDSYIN
ELSRFALMGTITEKNGWLINNGIYYTGRLGIFHSTGTKGLQVVTDAMKIYPYLGEQYFVA
AEQITTNYGGKDANGNVVNLDQIREDGKKKYLPKTYTFDDGAIVLKAGDKVTEEKVKRLY
WAAKEVKAQFHRTVESDQPLEKGNPDDVLTMVIYNSPAEYQFNRQLYGYETNNGGLYIEG
TGTFFTYERTPQESIYSLEELFRHEFTHYLQGRYEVPGLWGQGKMYENERLSWFEEGNAE
FFAGATRTDNVVPRKSIIGGLSSNPAERYTAERTLNAKYGTWDFYNYSFALQSYMYNKRY
DMFDKVHDLIRKNDVTAYDAYRSALSKDANLNKEYQDYMQMLVDNREKYNVPLVSDDYLA
THAPKPVSDIAAEITAEAKLSNVSVKKNKSQFFNTFTLQGTYTGTSAKGEYEDWKTITQN
VNDTLKRLSAKEWTGYKTVTAYFVNYRVNASGQFEYDVVFHGINTEEGAVNKAPVAVING
PYSGHTNEAISFKSDGSKDEDGKIASYNWEFGDGAVSNEQNPTHVYTKEGTYTAKLTVTD
DKGLTNTATTSVTVQKKEDNSVEKEPNNSFQTANKLQLNQVLRASLGNGDTSDYFEINIE
TAKNLQINVTKENNIGVNWVLYSEADLNNYVTYAQQQGNKLVGSYYTYPGKYYLHVYQYG
GGTGNYTVEVK
Download sequence
Identical sequences A9VNP0 J8C7K4
315730.BcerKBAB4_3229 WP_002142651.1.85012 WP_002142651.1.99908 gi|163941149|ref|YP_001646033.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]