SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 315749.Bcer98_0486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315749.Bcer98_0486
Domain Number 1 Region: 859-966
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.02e-31
Family Collagen-binding domain 0.0000983
Further Details:      
 
Domain Number 2 Region: 737-850
Classification Level Classification E-value
Superfamily PKD domain 9.42e-23
Family PKD domain 0.0012
Further Details:      
 
Weak hits

Sequence:  315749.Bcer98_0486
Domain Number - Region: 581-656
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.00392
Family MazG-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315749.Bcer98_0486
Sequence length 967
Comment (Bacillus cereus cytotoxis NVH 391-98)
Sequence
MNKKSKITQMMLGISTVALSFGSIQTQVSAEEKIPYNVMQMKPIGVETQTDQIAHVSQEN
KTLSFEERLRTGDFSQRPAFGMKRTESKQFQESYSMADFNKMNNEELIDTLANIRWNQIT
DLFQFNQDTKTFYQNKERMQVLIDELGRRGSTFTKDDAKGIDTFVEVLRSAFYLGFYHKE
LNYLNERSFHDKCLPALKAIAKNPNFKLGTEQQDTVVSAYGKLISNASSDVETVQYAANI
LKQYNDNLATYVSDFMKGQAVYSLIQGIDYDIDSYVYASYKEANQTMWYGKMDAFVNEVS
RIALLQHVTTENSWLINNGIYFAGRLGKFHSDPNKGLAVVTQAMHMYPHLSDAYFVAVEQ
IKTNYGGKDYNGNKIDAEKIREEGKQRYLPKTYTFDDGSIVFKTGDKVTEEKVKRLYWAA
KEVKAQYHRVIGNDKALEPGNPDDVLTVVIYNSPDEYKLNRQLYGYETNNGGIYIEQDGT
FFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLFGEGDMYQNERLTWFQEGNAEFFA
GSTRMNNVIPRKSIISGLSSDPANRYTAERTLFAKYGSWDFYNYSFALQSYLYNHRFEIF
DQIQDLIRANDVKNYDAYREALSKDANLNTEYQAYMQKLIDNQERYNVPEVSDDYLAEHA
PKALTEVKKDIEDTTNLKGATIKKHKSQFFDTFTVEGTYTGSTTKGEAEDWKEMSKHINQ
SLEKLTQKEWSGYKTVTAYFVNYRVNAENQFEYDVVFHGIATDSGENQAPVVNINGPYNG
NVNQAIQFNSDGSKDEDGKITSYLWDFGDGTTTTEANPKHVYKQEGTYKVTLTVKDDKGK
EAKTETTVTVRKGHETTVESEPNNRLEEANPIAFHTLIKGSLMNEDRTDIYTFDVTSSKN
IDISVVNEHNIGMTWVLHHESDMQNYVAYGQANGNDIKGKFEAKPGKYYLYVYKFDNGNG
TYTLSVK
Download sequence
Identical sequences A0A255KR19 A7GL33
315749.Bcer98_0486 WP_011983597.1.32677 WP_011983597.1.78077 gi|152974319|ref|YP_001373836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]