SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 315750.BPUM_2790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  315750.BPUM_2790
Domain Number 1 Region: 325-359,392-661
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.7e-67
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 95-195
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000000126
Family Sensory domain of two-component sensor kinase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 315750.BPUM_2790
Sequence length 663
Comment (Bacillus pumilus SAFR-032)
Sequence
MKNALKWLKKPSISKRLIISFTLVLVLPIITLSTISYQIAKEELDHEIMYGANARVNELN
DMIQQKLVNKENAVKLFTETSSAADFKKNNQDELYEHFEIYSKINDEDVVGFYAASKKRD
FIQFPKVDMPKGYDPTTRDWYQLAMQDDSGNPVVTNPYISATTNGMVVTIAQRLKDGSGA
IGIDIDVQDIVDKIKEIKIGREGYPIIANKNKQIVAHPEEKSGSKVTENISSILYSGKEG
TSTYENKGEQKRLVFVTNDLTGWKIAGTMFVSETEEAAQPVWNSAIILLISSFILGGIAI
FFIVRSITIGLRKLVDFSEKVSEGDLTETLETKSKDEIGDLTRSFSKMSESLRDVIRAVQ
QSVDNVASASEELTASASQTSQATEHITMSIEQFSNGNDAQNEKVESSTNQLVAMNEGLQ
GMSQTSSEVASVSLQSTEAAGQGGRIVESTASQMKHIDTSVQEAEQVMKQLEFKSKDITS
ILNVINGIADQTNLLALNAAIEAARAGESGRGFSVVAEEVRKLAVQSADSAKEIEKLIQE
IVLEIAKSQDMFKTVNREVHAGLGMTEEAKESFQNIYEAAEGMSKKLTQLNDTAIDLSSG
SKLVSQAMQEMRQVSRESAANIQDIAASAEEQLASMEEISSSSVTLANMAEELKELTSQF
KID
Download sequence
Identical sequences A8FGS8
gi|157693543|ref|YP_001488005.1| WP_012011068.1.28396 315750.BPUM_2790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]