SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_1891 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_1891
Domain Number 1 Region: 23-124
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000458
Family Thioredoxin-like 2Fe-2S ferredoxin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_1891
Sequence length 142
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MDHAAEHAPGQRPSRDSVDPMVTLHVCVNCLAGEDRDSHPRAGARLYQALLEAQQRQDQP
PEVHIAAAECLSNCNRGCSAALCGAGRWSYVYGDLTEAAVDDLLAGAAQYAATADGLVPW
RERPTIFRKGVIARIPPVPRPA
Download sequence
Identical sequences Q217I8
WP_011472352.1.69038 316056.RPC_1891 gi|90423397|ref|YP_531767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]