SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_3336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_3336
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.03e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 85-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.7e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_3336
Sequence length 218
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MALILVIGNKNYSSWSLRPWLALKATDIAFDEVVIPLYTGAADKQRILDVSPAGKVPVLV
DGDITVWDSLAIIEYAAERFPQAQLWPDDRARRAHARAVSAEMHSGFPALRNECGMNLHR
PVGAKPLSAAAQADIARIQQIWSECRQRYGQLGPYLFGAFSAADAMYAPVVHRFLTYAID
MPGELRSYVEAMTALPAFRQWTEAGRAETLVIDKFEQD
Download sequence
Identical sequences Q211Q8
316056.RPC_3336 WP_011473766.1.69038 gi|90424827|ref|YP_533197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]