SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_4124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_4124
Domain Number 1 Region: 78-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.32e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_4124
Sequence length 217
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MYKLYSMQRSGNSYKVRLALAFLDAPYRAIEVDILSGESRTPDFLAKNPSGQVPLLEVAE
GRYLAESNAILWYLGVGTSLAPESRIDRADALQWMFFEQHALEPNIGAAYFWLSLVKGGR
DLQTHALEDWMERGYAALQVMENHLKDNDYFAAGQLTIADIALYGYTHVADQCDFDLEAF
PAIGAWLKRVQQSPGYVSMNWRPESISDDAPGIAAEA
Download sequence
Identical sequences Q20YY6
WP_011474531.1.69038 316056.RPC_4124 gi|90425599|ref|YP_533969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]