SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_4315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_4315
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.47e-29
Family ArsC-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_4315
Sequence length 145
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MAKVTFYEKPGCGGNAKQKALLLASGHDVEVRNLLTQPWDAASLRPFFGEKPVADWFNAS
SPRVKSGEIRPNEIRPDVAIAMMIEDPLLIRRPLMQVGEHRQSGFDQAAVDAWIGLRPTE
TEVTDRCLKEGDAAHAAACRAAAEP
Download sequence
Identical sequences Q20YE8
316056.RPC_4315 gi|90425787|ref|YP_534157.1| WP_011474719.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]