SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316273.XCV1035 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316273.XCV1035
Domain Number 1 Region: 79-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.00081
Further Details:      
 
Domain Number 2 Region: 1-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.17e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316273.XCV1035
Sequence length 204
Comment (Xanthomonas campestris vesicatoria 85-10)
Sequence
MKLYTKPGACSLADHIVLRWSGLPFDLSVVDAATMKSPEYLRLNPAGSVPLLMVDDWALT
QNAAILNYIADIAPLTGLSGDGTARSRAEINRWIAFVNADVHPTFKPIFGSTAYLQDPAL
IARSQDDARSKLRTLYERVDAHLQGRTWLASDSHTGADAYLFVTLLWAQKVAVNLDGLNA
LQAFVQRMLADADVQAALKAEGLA
Download sequence
Identical sequences A0A0G9CGU4 A0A1S1XFP7 G2LUE1 Q3BWU7
gi|78046591|ref|YP_362766.1| WP_008571654.1.100156 WP_008571654.1.100312 WP_008571654.1.10442 WP_008571654.1.11230 WP_008571654.1.12827 WP_008571654.1.14159 WP_008571654.1.16263 WP_008571654.1.17112 WP_008571654.1.19776 WP_008571654.1.199 WP_008571654.1.20169 WP_008571654.1.21303 WP_008571654.1.21317 WP_008571654.1.2230 WP_008571654.1.2259 WP_008571654.1.23534 WP_008571654.1.24172 WP_008571654.1.25231 WP_008571654.1.29361 WP_008571654.1.3003 WP_008571654.1.30677 WP_008571654.1.331 WP_008571654.1.3440 WP_008571654.1.37569 WP_008571654.1.37942 WP_008571654.1.39371 WP_008571654.1.40690 WP_008571654.1.43396 WP_008571654.1.43419 WP_008571654.1.44794 WP_008571654.1.46449 WP_008571654.1.46677 WP_008571654.1.47244 WP_008571654.1.47958 WP_008571654.1.49886 WP_008571654.1.50405 WP_008571654.1.5224 WP_008571654.1.54158 WP_008571654.1.54709 WP_008571654.1.55770 WP_008571654.1.56262 WP_008571654.1.57452 WP_008571654.1.59767 WP_008571654.1.60785 WP_008571654.1.61221 WP_008571654.1.64411 WP_008571654.1.656 WP_008571654.1.66420 WP_008571654.1.67180 WP_008571654.1.67877 WP_008571654.1.6838 WP_008571654.1.72305 WP_008571654.1.75734 WP_008571654.1.772 WP_008571654.1.78066 WP_008571654.1.79359 WP_008571654.1.79878 WP_008571654.1.80975 WP_008571654.1.81489 WP_008571654.1.85024 WP_008571654.1.85152 WP_008571654.1.8544 WP_008571654.1.86099 WP_008571654.1.89212 WP_008571654.1.89360 WP_008571654.1.94781 WP_008571654.1.94946 WP_008571654.1.96073 WP_008571654.1.9928 WP_008571654.1.99285 316273.XCV1035 gi|346723916|ref|YP_004850585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]