SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316273.XCV2940 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316273.XCV2940
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.16e-34
Family Thioltransferase 0.0023
Further Details:      
 
Weak hits

Sequence:  316273.XCV2940
Domain Number - Region: 137-187,222-261
Classification Level Classification E-value
Superfamily TPR-like 0.000531
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316273.XCV2940
Sequence length 285
Comment (Xanthomonas campestris vesicatoria 85-10)
Sequence
MSDKPHVFDATTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFEL
GKVDVDKEQQIAAAFQIRSVPTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQV
AEDVPPAPLDPQAQAAALREAVAAEPDKDELKLDLALALLKTGDTAEAEQLIDALPANLA
TDDRAVCAKARLSFANVLKDAPDAGTPQAAVDANSADLRARHLLGVRHLLDGNDEAALEQ
FLEMLRQDRSFDDNLPRRSLIDAFRVIQDEDLVGRYRRKMSALVF
Download sequence
Identical sequences Q3BRE2
316273.XCV2940 WP_011348006.1.100156 WP_011348006.1.331 WP_011348006.1.46449 WP_011348006.1.46677 WP_011348006.1.60785 WP_011348006.1.89212 gi|78048496|ref|YP_364671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]