SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_0045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_0045
Domain Number 1 Region: 40-97,149-209
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000235
Family Collagen-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_0045
Sequence length 1012
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MRRFSKVRLLGICVLLLSLTAYQRTPNSSAQVLRSLVPVPEVESNDTWQNAHDLTSSCLW
PSITICDVTGELDDGEDLDWYKITVRPATTLSISLTDTFGDYQVALFYDLAKPITQTGHV
SLGNLNAIGNLNAIGNLNAIGNLNAIGNLNAIGNLNAIGNLNAIGNLNAIGSNGYSDASI
DSFLWTPGFYYVLVYPLDEDQSGDYNLAIEATFDQNLTKPLPIPFMINQSEPPDCKRSLY
ITNSDYFNIYEAFAPYNTSVYTELLGLASKPGDTSGLVLDLANISWIQPSNAFSDQSTQW
DNNRNNPFYANRIAEGVHHLITQYARRCASLRYVTIVGGDYVVPFYRVPDETVIANEGDY
LASSGINTNSFTASSLKYKTILTDNIYGAIKPIPYRGRQLWVPELSVGRLVEGADAIHLY
LKSMNLHTDFPSGSMINLNPQPQQANLVTGYDFLLDQAKVISGTLTNLVGARPVGLISDT
WDADDLLSIWWPDVNNGMSNSPYPAQSINAHFTHYQAIPANFETSTDVVEAKVLFQHPFS
PVALEDAYQRNRLGYSVGCHSGYSVYDNDVAGGLTNPVAIDFPQAYMKQHGAWIGNTGFG
YGDSDLVGYSEKLMAQFTLEIGREWKNQSGFYGGMPIGYALVRAKRSYLREGTPGTFSVY
DEKVLLQSTLYGLPMIRVLVPNPIPFPPNDRQDFACLTCPPSVAHRATVTDRAIDRDITF
NINYTTAQDNARGKILRAQATVVNDTEGLLTGQMFNSSLVNAAGLPSLPNFSIPLSLTDG
FGEQRIQGIQFLGGTTTTAATFNPVITRLITDEIYLSHEPTFDFTDRWYPDQPFSYSVFE
SDNLDDDGPLNQDRRFSQLLLTPTQFKGNTSGGELRQFSTITLRLKYLSDGADDDLLDDT
FDPIVRDTQRTSDGKIRAIVIERDNDGPGDELDAEMVVKTNTGAWQTVSMNTFQIGTTER
WQIEGSLPANTFLPLQLLIQAEDEAGNVGVETYGGRFDIDYEMYLPNVNVNR
Download sequence
Identical sequences A9B4E0
gi|159896578|ref|YP_001542825.1| 316274.Haur_0045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]