SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_0344 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_0344
Domain Number 1 Region: 313-450
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000964
Family Proprotein convertase P-domain 0.03
Further Details:      
 
Domain Number 2 Region: 51-161
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000288
Family Collagen-binding domain 0.0051
Further Details:      
 
Weak hits

Sequence:  316274.Haur_0344
Domain Number - Region: 178-237
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00262
Family Collagen-binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_0344
Sequence length 716
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MRLRIGFIGLMIALLGLTGSLRAFKPVQAAPSNPTTAQIAQANVPQGAVRVKEQESNNTT
ATANAIMSSSTLIRGNIWNGDVDFYSIELAAGDRLTAATMSAASASGNNDTVLTFFAPDG
TTVIETDDNDGSLGGNASVISSAPVTQTATYYLRLSSTSTNQVRYYDFYVRVLSEAATAE
TEPNDLLTTAQVLPTSGTISGVLSATTDLDYYQLNLNAGDTIFTSLDLNPERDGIVWNGR
LGIGAFNGFTLVVDDTSVVSPNAEAHFMTVKTSGTYYVLASTTAASIPAEATYLLGVTVF
PAEQQANCTTYTSADVAKTIPTTTSFITSTLTVPDNFIIADLDVSIELTHTNMPDLDVQL
QGPDGNVGGLFTDISNNTQTTMNIDLDDEAAIPIGLFAIVSGIRYIPELNYRLDWFDGGR
SAGTWTLLIHDDTAANGGTLQNWSITLCAAPPASCPDGMSMSTITSTDFEANDGGFTHSG
TADSWEYGAPSAAPLIGSYSGANSWKTNLDGTYSVSSIANLFSPSISIPNVTGPVYIQWQ
QRYQMESANFDHYTASVGTGVVTKTLYEFDAATMTNAVGNPSVTFQESTVWSRQLYDISE
FKGQSIQALYHLDTDSSVQLGGIAIDDFQIMACDGVAATATPTEAPTATSTPTNTPTNTP
TNTPTNTPTNTPIITITPSNTPTATVTPSNTPTVTPSVTAGPTMIPVYMPLVGKDQ
Download sequence
Identical sequences A9B7M3
gi|159896877|ref|YP_001543124.1| 316274.Haur_0344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]