SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318161.Sden_3090 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318161.Sden_3090
Domain Number 1 Region: 219-277
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000131
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318161.Sden_3090
Sequence length 472
Comment (Shewanella denitrificans OS217)
Sequence
MKSLKFIALISVFTTPLAFAGTAISDQADPAADVSSEVYIELSTADILDNFPIGEGRNIP
RETKVNLVTSLRTSLSKVQGGAKLRGLMMESPKVANTTSAAPHQINCAQAYNLSEDIVYT
DTISSVGEQHCFVMPLSQKSKVVGQLLAADMASNFNLYLYQYDDTQGILAHVDSSENAAG
IIEKAYAVLPKASYILVAELMSGAGGAFNLIGNSFSSYDNFEPNDSDITSKIPAITVGQI
VTGNLDNPEDVDYFGYKLKSNETELKINVSGSAEHQVEIFNAGAWQVLPHDQLINANGSA
GATYYIRTLAKPSTIPSALNNYKITTSNSFAKFADFDVWTTDRNLTDLVDYVHTEAFSNL
SAGGKVVDSSGSPLVGEKMVVATVVNGEQIHKIVTTNALGKFSASFDLPRCSGDIITGTF
DSNFGTPRNIWEIKYKAPQVIEIYPLTKKNQNTLRPMYIHICKETLKQHIPG
Download sequence
Identical sequences Q12JK9
318161.Sden_3090 gi|91794439|ref|YP_564090.1| WP_011497513.1.19895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]