SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_0183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_0183
Domain Number 1 Region: 41-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-30
Family Glutathione peroxidase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_0183
Sequence length 184
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MKKFVLFIPLVIFLGMGVFLYKGLFLNPKVLDSALEGKPVPAFQLERLEVPSEVLTEKDL
PAKVSMLNFWATWCPACKYEHPYLMMLSKRNLLPIYGINYRDERALAVKELTTQGDPYTV
NIFDKDGRLGLDLGVYGAPETFIVDHNGIIRYRYAGPIDQTVWTQTLYPMIQQLQAEAKV
DGAS
Download sequence
Identical sequences Q089L9
gi|114561371|ref|YP_748884.1| WP_011635673.1.15765 318167.Sfri_0183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]