SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_0818 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_0818
Domain Number 1 Region: 23-214
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-26
Family DsbA-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_0818
Sequence length 218
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MIKYFAIVLTLITASFSTFATPFVAGKHYTQISNNMVPSEPKVTEFFSFYCHNCFNMESQ
YLPEIKAGLDKKITFDSKHVDFMNSDLGTEVMRALAVIHELDNKEALKIAMFGAIQGKDN
TGGHDHAAAGHEHKSQINNRDDIKNVFAQFGVDAKQYDTVADSADTNKKLTMWRQQQVTY
AVQSVPAFIVNDKYAINLNEMRSLDDIIGVINYLALKQ
Download sequence
Identical sequences Q086Z2
318167.Sfri_0818 gi|114561998|ref|YP_749511.1| WP_011636296.1.15765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]