SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_1726 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_1726
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-18
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_1726
Sequence length 76
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MKIIKVLGSGCKKCLETAELAQAIADEKGVAIKIEKVTDMAQIMAYDVMSTPAVVVDEKV
VHKGSKPTKDQMAMWI
Download sequence
Identical sequences Q083I9
318167.Sfri_1726 WP_011637192.1.15765 gi|114562901|ref|YP_750414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]