SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_0680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_0680
Domain Number 1 Region: 73-204
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.71e-23
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 7-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.82e-16
Family GntR-like transcriptional regulators 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_0680
Sequence length 226
Comment (Paracoccus denitrificans PD1222)
Sequence
MDAQPESQIVDAVLNAISEQRLPAGAKLGEQALSELFNCNRANVRRALASLAAKQVVELR
PNRGAFVVTPSAQEAREIFQARRAIERTIARQAVARVRDEDVAYLRANIAAETEARARRD
KPAELRLSQQFHMYLARLSGNRVLERFLAELTMRSTLILGMYPSAKHACSNCDDHVGIVD
ALMARDEELLLRLTDEHLRHLEAELNFDLPPVSSVSLKDQLLGSPA
Download sequence
Identical sequences A1AZU8
gi|119383432|ref|YP_914488.1| WP_011747025.1.25907 WP_011747025.1.3707 WP_011747025.1.52749 318586.Pden_0680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]