SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_1431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_1431
Domain Number 1 Region: 78-204
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-20
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.26e-18
Family GntR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_1431
Sequence length 222
Comment (Paracoccus denitrificans PD1222)
Sequence
MKHAPEETQSARIARVLADRIISGEIPPGARLRQDHIAAEFGASHVPVREAFRELQTQGL
AESQPRRGFRVTEFDVAELREVAEMRSSLESLALRHASPNMTRAILQEAEEVTRHGDNAS
TVRDWEAANRHFHRIILSPCRMPRLLRTIDDLQAASARFLFAAWRRDWEARTDHDHRAIL
DALRKGQTDLACATLARHVGWIGKRKTAVKNADLRETYEIPG
Download sequence
Identical sequences A1B1Y8
318586.Pden_1431 gi|119384172|ref|YP_915228.1| WP_011747750.1.25907 WP_011747750.1.3707 WP_011747750.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]