SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_2929 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_2929
Domain Number 1 Region: 96-230
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.23e-26
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.21e-18
Family GntR-like transcriptional regulators 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_2929
Sequence length 257
Comment (Paracoccus denitrificans PD1222)
Sequence
MPSEVNKGAPAAETTARHIEDLILEGSLRPGDPLLPEREMALRLNVSRPTLRQGIRMLEE
RGLIVADPGGGRRVAPLATSITDPLIELMASRGEVVDDYLELRGTLEGMAASLAATRASD
VDRATLTRCMERIDLAHDEADFRDEAEADVDLHVAVYEASHNVVLLQIMRALSGMLRKGV
FHNREKLYARPEVRDVLRAQHRAIYDAIMVRDPEAAARAAQDHMTYTKRVRAEIIAAEAR
LEISLRRIEGGSLTARN
Download sequence
Identical sequences A1B669
gi|119385654|ref|YP_916709.1| 318586.Pden_2929 WP_011749203.1.25907 WP_011749203.1.3707 WP_011749203.1.52749 2005168847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]