SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_3206 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_3206
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000215
Family GntR-like transcriptional regulators 0.044
Further Details:      
 
Domain Number 2 Region: 99-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000131
Family GntR ligand-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_3206
Sequence length 236
Comment (Paracoccus denitrificans PD1222)
Sequence
MPRSKSEYVAQRLLDRIITDNLASGSYLGTEAELLQQFNVSRPTLRESLRILETQGVIEL
RPGPGGGIMITRPGTDIVAHGLSVYLRVHGIPDTTMHRALIALQPALIAQAAEMGSADDF
DALDAVVEKMRLTSDLRELRQELRHFYLLIARATQNQILDIFWSTLDKLSGGPASTLEGE
KITAAGRQRIVALHGEMVSACRAKDPSTASALLNALLSAPSPSQTQSRRRQARSEA
Download sequence
Identical sequences A1B6Z3
gi|119385928|ref|YP_916983.1| 318586.Pden_3206 WP_011749472.1.25907 WP_011749472.1.3707 WP_011749472.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]