SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_4243 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_4243
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 9.42e-28
Family GntR ligand-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_4243
Sequence length 175
Comment (Paracoccus denitrificans PD1222)
Sequence
MRSLQTLGLTRSRSGSGSFVISDRQAPELAYGNYSARELIEARPFIEIPAAGWAALRRSE
EDMARLLQLCDSMERQEDALKWVRLDSDFHCLIAEAARNRLFARIVTDSRDSLMRQSELV
NLMADRRVTSNHEHRRIAEAIAAGSETEARTAMRDHLHEVEQAMTWIISQRPANS
Download sequence
Identical sequences A1B9W3
gi|119386948|ref|YP_918003.1| 2005169798 318586.Pden_4243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]