SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_2477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_2477
Domain Number 1 Region: 157-582
Classification Level Classification E-value
Superfamily Subtilisin-like 8.81e-103
Family Subtilases 0.00000000000228
Further Details:      
 
Domain Number 2 Region: 711-822
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.08e-22
Family Proprotein convertase P-domain 0.026
Further Details:      
 
Domain Number 3 Region: 56-65,95-153
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000132
Family Subtilase propeptides/inhibitors 0.0044
Further Details:      
 
Domain Number 4 Region: 621-691
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000575
Family Collagen-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_2477
Sequence length 823
Comment (Shewanella putrefaciens CN-32)
Sequence
MINTKLTMDENMTRNKGTKIALGLSSLTIAISVGINAAPLPLDLAAGMQAQTSPLPKRYI
VKFKNADTAAAMSANNLQSTEGVQVDALPTTMDYQPMVAEISAQHSALNKVQAKEMKRIG
RTNSYSVKLDAKGISALKSRPDVEYVEEDLPRHFLSETTPWGQTYVGATQLSDSQAGNRT
ICIIDSGYDRGHSDLNGNNVTGTNNSGTGNWFEPGNNNAHGTHVAGTIAAIANNDGVVGV
MPNQNANIHIVKVFNESGWGYSSSLVSAIDTCVTNGANVVTMSLGGSGSSTTERNAMAAH
YNNGVLLIAAAGNAGNSTHSYPASYDSVMSVASVDSNKNHSAFSQYTNQVEIAGPGEAVL
STVTRGEGRLADITIGSQSYFDAGVVPHNRYVSSGSNYVPAPFNGTATAALAECTVSGTS
FNCGNMTNKICLVERVGNQGTSYPEINAVKACKNAGASAVIVFSNTSLPGLQNPFLVDAN
NEANLVSVSVDRATGLALRNQIGATVTVSNQGNKDYEYYNGTSMATPHVSGVATLVWSYH
PECSAAQVRNALKMTAEDLGTAGRDNYYGYGLVNAVAAKAYLDASCNGPTDPVDPTEPGD
SVLVNGVAKTGLAGAASEELHFSFEVPAGATNLGFVMNGGTGDADLYVQYGAAPTTSNYD
CRPYKSGNSESCSITNIQSGTYYAMVKGYSAFSGVSLTASYTASNDGGAPTSYSNTDNYN
IPDNKAAGITSPITVTRTGDSGTVTVVVNIVHTYIGDLKVQLISPSGKTFTLHNNTGAGT
DNINKSYTADMAGVDSNGIWKLKAVDSSRGDVGYIDSWELSFN
Download sequence
Identical sequences A4Y8B5
gi|146293573|ref|YP_001183997.1| 319224.Sputcn32_2477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]