SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_3115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_3115
Domain Number 1 Region: 3-66,103-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000157
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_3115
Sequence length 153
Comment (Shewanella putrefaciens CN-32)
Sequence
MKISELQKERGIELPSDYLEFVAGIDAGEDYCFNKFPDEYPDFEGRCWAFFDEELLCENI
EMSGVGNAPAHRQLELYLKCYREFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTTA
Download sequence
Identical sequences A4YA44 E6XM69
gi|146294202|ref|YP_001184626.1| WP_011919918.1.82224 WP_011919918.1.85280 gi|386314921|ref|YP_006011086.1| 319224.Sputcn32_3115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]