SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319795.Dgeo_2223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319795.Dgeo_2223
Domain Number 1 Region: 216-327
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000575
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 87-209
Classification Level Classification E-value
Superfamily PKD domain 0.00000051
Family PKD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319795.Dgeo_2223
Sequence length 343
Comment (Deinococcus geothermalis DSM 11300)
Sequence
MKPHRTLSFALLSGALLLTACGTGSTPPDTMAPKITLSASPKALTKPGSVKLTADASDNV
GVSKVEFYRGDSKIGEATAAPYELSVNVTAADNGTVTYRALASDAAGNTAEATVNVDVSV
DVTKPTVSVSAQPSSLTLPGTVTLTATASDDRGVTKVEFYDNGQLVATDTGAPYTASQTY
GFADNGNHIISVKAYDEQGNVGESATTLNVAISDANEPNDNPTDATPLTIGTALNGTIAG
QGRDFDYFKFDAAQGDMLKLTVKSVSVDPASTLDPYVMILMPDGKTVLEKDDDSGAGLES
EIRFNAPVAGTYTVVVTSFDIYDDEQLTDDRATNTYQILLTRR
Download sequence
Identical sequences Q1IW67
319795.Dgeo_2223 WP_011531338.1.71355 gi|94986322|ref|YP_605686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]