SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3218.JGI103262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI103262
Domain Number 1 Region: 23-296
Classification Level Classification E-value
Superfamily Subtilisin-like 2.36e-85
Family Subtilases 0.00000602
Further Details:      
 
Domain Number 2 Region: 414-529
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000641
Family Collagen-binding domain 0.0043
Further Details:      
 
Weak hits

Sequence:  3218.JGI103262
Domain Number - Region: 322-402
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0315
Family Family 6 carbohydrate binding module, CBM6 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI103262
Sequence length 937
Comment (Physcomitrella patens)
Sequence
MTLVDVKPMVAFADSNDRYYDNQQHLTQIRADKAWQTVNSNTAITIAVLDTGADYNHPDL
KGNLLPGINLVNAGRSAQDDNGHGTEVTGVLAAKGNNGIGVSGVLWNAKVLPIKVLDSRA
VADLDVVARGINTALDRGAKVILMSVSSMSYSKALTNAVNRAEASGAVLIAASGNEGNRV
AYPAAYPTVIAVGGVKSNNEPIYESNSGPELNLMAPGLNVYTTKLGSTYGSFSGTSAAAP
QVAGAAALIMARYPKLRPIDVRQLLYQTATNLGESGWDKRTGYGLLNVEKAVTSAMSQDF
LEPNNVLSRAKAFPIEQQIRGNLGPNDTTDWFKMDVPYDGRVSFTASVNSSVSSPMAATF
YSENRTPVTHYIGNGDTITVSAKAGRMDIRLVRNGGVNAFSYVLTSRFSINPDRNEPNDT
NGTARPLVGNQISVNGSFHTEGDQDWFSYYVREYGHLDVTVTPDNKRMDPVLAIGKQGQG
NSTTWDPLYDNGDRDDPAEHASKEVSPGKYLLRVSEYEQNAVNGEYRLDLSFTPVKKDVN
EPNDAYRQASYLAVGSESYVYVRAPFIPVSSGVRIALYSANNFNYALASTNEVAELSDQG
KDIFGLRLKPGKYYIRLNSGVPFKYDAYRLTVNQQVLVGGYRDISSHWARSEIVRLSNRG
IVKGFADATFKPNQAVTRAQFATMLISAMRSDGLPVASSYTGKTTFRDLPKKHWAYNNMG
IAYQVGIMKGYPNKQMKPDQPITRAEMASMIARAHNVLLYKRSTTSYRDVPTSHWASPAI
EALTSRNWLNGYGSTFKPQAAIGGTAIFASQAMADGVGGVPGSVDDPVVTKSYVDQQIQA
AGGGGSTLTVVEVNPGQTLYGFEGTEFIVRTGKVQAVAGNNGDGLTDLTAGVDLRGGAVV
GTNHLLLIARSDNRGLRLAPGYDGISHVMVRGKYTLR
Download sequence
Identical sequences A9U6I5
3218.JGI103262 XP_001786470.1.60028 jgi|Phypa1_1|103262|fgenesh1_pg.scaffold_1736000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]