SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_0356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_0356
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-34
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_0356
Sequence length 103
Comment (Methanospirillum hungatei JF-1)
Sequence
MEGKKLYVGNLPYSTNESQLSELFSSYGEVVSAKIIENKGFGFVEMGTSEEAQAALDALN
DTEFDGRTMRIDEARPMQPRRDFGGNRSGGFGGSSGGFNRRRF
Download sequence
Identical sequences A0A1V5SYC6 Q2FLA6
WP_011447420.1.85653 323259.Mhun_0356 gi|88601667|ref|YP_501845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]