SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_0894 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_0894
Domain Number 1 Region: 415-466
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000183
Family Type I dockerin domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_0894
Sequence length 472
Comment (Methanospirillum hungatei JF-1)
Sequence
MNLLPSGVRIFLLAGLMVASGMICLITAADYSIGTIIEATGPVRDSFTGTFSQADGNGTN
VSGVYSDSVMTNGGSLSLTKQVDMSEKSSGQGFETQKVVGYSSGTSGGHLIADEYVLTSS
DMYSNKTQGAICFGDPYLVSSCISGEQSASFSIANAKTLTLASAGRSSNGTLDYSLSIGT
PQSNASNPGLEGTVISAIHGKTKTQSGEVSLYDRTLISGLITTFTRLYHGGEQQELSEMT
STTGSVHDKTILEQKYSQNDTTSGKISSGTAVYAQDVMTNGGKTHETRQISGSGSISSER
LVEYTSDGDRSIQASEHVVATRMSEGQEDSGTPACALGGTTSSGEEKSPYKQASAQTGIA
GVSSARISSTTRISDPERSDELNLEYNANVMIPIGFNASMVQEMKDTDNDGRFEDLNGNG
RLDMHDLVLLFQNFRWIGESNLSLRIDFNKNGRADYADIVTIFNSMNQTSSK
Download sequence
Identical sequences Q2FQ05
gi|88602185|ref|YP_502363.1| 323259.Mhun_0894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]