SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_1146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_1146
Domain Number 1 Region: 23-130
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.63e-23
Family Anti-sigma factor antagonist SpoIIaa 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_1146
Sequence length 134
Comment (Methanospirillum hungatei JF-1)
Sequence
MASPDVETDLIYTLKKEAGSALPIDIWYEGEMWIFHPIGSIDTTTSSDLEGTLIEGINQG
MRWIILDLTDVRYISSAGIRVFIAAAKTLKEKKGELLFSTPNKNVSDILRLSGLFKIFKV
YPDNAAAIRSFTVK
Download sequence
Identical sequences A0A1V5SSS3 Q2FP24
gi|88602435|ref|YP_502613.1| 323259.Mhun_1146 WP_011448172.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]