SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_0232 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_0232
Domain Number 1 Region: 103-207
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000157
Family Collagen-binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  323261.Noc_0232
Domain Number - Region: 258-367
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000445
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_0232
Sequence length 431
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MKNLARHCFIFLGLLLVPTLGAAGLNIFPELDSNDNNNTSSNNTSQESTQNFSNTADPEP
EADTNASPPANKDEIIAETKAGCATDPASCGVTLSSFLDSTGFGETEPNNHAMGADAMEF
GVEYAGQLYSPEDVDWFRITTTESNQMLTVNFNVPGLNDITGWNLSIRDSGGNIFSEVYT
GFDFGPESPLQTILSRAGTYYVVVKSLKQAQEETRSSDQSGEADLIYEHLPHEYRLAAFL
GDSQVTTEPLDVNFFDAEVEPNDSRDEANPLTFATPLASNVTMEGLISGPLIFGSVGFAF
EEDWFVYDTAGNEILSIEFCASQDCEDSTWQVTVYDENERMLLTGRTDMEQNYYLGIRNP
GKYFIRIGVAPALDEESGGAQYVCSIDPTMPLKDCPSPSERTLLVESPWHQYNFTVTSTK
LPPLMSEVDNP
Download sequence
Identical sequences A0A0E2Z5S7 Q3JEI4
323261.Noc_0232 WP_002812012.1.20919 WP_002812012.1.60716 WP_002812012.1.77844 WP_002812012.1.91979 gi|77163767|ref|YP_342292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]