SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_0603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_0603
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.82e-33
Family Thioltransferase 0.0049
Further Details:      
 
Domain Number 2 Region: 117-172,208-256
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000446
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_0603
Sequence length 287
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MSENNYILDITEANFAEQVLTKSYQTPVLVDFWAAWCQPCQMLMPLLKQLAESYQGQFWL
AKVNADEAQSLTHQYGVRGLPTLKLFRHSEVVEELVGVQPESAIRAAIDRHLIRESDLLL
EQAQTARATGQEERSLELLHRAAEIDPKNHRISLTLAETLLKQGEIAEAEQILTTLPREI
REEEPASGLLAQIEFTAFASRAPDIALLKQRLKTNPEDSEARYLLGVQQAFSRDYQGALE
QFLDLLKRDPKYGDSAARKALLAVFSILGSDHELVPLYRRQMFRCLH
Download sequence
Identical sequences A0A0E2Z3W4 Q3JDH4
gi|77164127|ref|YP_342652.1| WP_002813212.1.20919 WP_002813212.1.60716 WP_002813212.1.77844 WP_002813212.1.91979 323261.Noc_0603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]