SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_0650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323261.Noc_0650
Domain Number - Region: 91-123
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00644
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_0650
Sequence length 134
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MVLTSTLSAPAIAGEAAPAIEVFTDSTFQVVSASDNTTVYVMDRINQLLQVLSEDLPSDP
ENAKQLVLARFQRMDAQLSSELENAAKGLVQAMQYGINRYPAIVINGNAVVYGVTDVSAA
TQLYQRWQTRGARQ
Download sequence
Identical sequences A0A0E2Z9N8 Q3JDC7
2005420387 WP_002813132.1.20919 WP_002813132.1.77844 WP_002813132.1.91979 gi|77164174|ref|YP_342699.1| 323261.Noc_0650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]