SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_1324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_1324
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.97e-43
Family Glutathione peroxidase-like 0.00000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_1324
Sequence length 190
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MHRIEYVPDATFKTRVRDESLEGSNPYRWQDITSKEIFAGKKVIVFSLPGAFTPTCSSNH
LPRYEELYDEFKAMGIDEIYCISVNDAFVMFQWSRHMEAKKVKMLPDGNGEFTRKMGMLV
DKSNLGFGMRAWRYSMLVDDGKIEELFVEPDFSDNCPTDPFQVSDADTMLAALKGEEPTE
VSEPRRAFVG
Download sequence
Identical sequences A0A0E2Z3I4 Q3JBH4
gi|77164827|ref|YP_343352.1| WP_002809619.1.20919 WP_002809619.1.60716 WP_002809619.1.77844 WP_002809619.1.91979 323261.Noc_1324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]