SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_2253 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_2253
Domain Number 1 Region: 95-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.81e-36
Family DsbC/DsbG C-terminal domain-like 0.0000429
Further Details:      
 
Domain Number 2 Region: 32-86
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000000000000114
Family DsbC/DsbG N-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_2253
Sequence length 245
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MGKKLLGFLLAGGLVTLSFSVVGDEEIKAVRASLQKLVPGVEPQSIKPAPIPGIYEVVLE
GQVFYLSQDGRYMVQGQLVDLATRTNLTEERLKVIRAAAISDLDEQNMIVFGPKQAKHTV
NVFTDIDCGYCRQLHQHIEEYNALGLKIRYLAFPRAGIGSSSYDKAVEVWCAKDPHQAMT
QAKAGKSVEDTAKCENPVADQFKLGQSLGVNATPTLMLEDGTVLPGLVRPQALVNLLEQK
VAAHP
Download sequence
Identical sequences A0A0E2YZY7 Q3J8Y5
WP_002808900.1.20919 WP_002808900.1.77844 WP_002808900.1.91979 323261.Noc_2253 gi|77165716|ref|YP_344241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]