SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_2900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_2900
Domain Number 1 Region: 50-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.75e-30
Family Glutathione peroxidase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_2900
Sequence length 196
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MRNRALCNLAAIMMLLLLAPTKLIASTIVLKHVAPLQKETIAHLNQGSKSDSGQWRLVVF
GFTNCSDVCPMSLANLSMLMGAAEEENIKLAGTFVTIDPDRDTHAVLAEYTDKFNADIAY
LRLTGKDLEHLKSTFGVETVFYTKNAGNRIHYQVDHSSTGFLIDPEGRIRVLFDAVEDAV
DIANMIHEQGTLFSHE
Download sequence
Identical sequences A0A0E2YZ63 Q3J750
WP_002813475.1.20919 WP_002813475.1.60716 WP_002813475.1.77844 WP_002813475.1.91979 323261.Noc_2900 gi|77166351|ref|YP_344876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]