SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323850.Shew_2971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323850.Shew_2971
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-43
Family SMI1/KNR4-like 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323850.Shew_2971
Sequence length 133
Comment (Shewanella loihica PV-4)
Sequence
MHDLIEQLRELSETVPVPLELPSFDQLVEVEEQILIPLPAELKEYLLYASDVIHGTLEPV
TAADPYAHTYLPEVTSYAWSIGMPREYIAICQQGDDFYCIDQEGQVMLWQDGELAEESWE
SFWQWVEEVWIPA
Download sequence
Identical sequences A3QH89
323850.Shew_2971 WP_011866768.1.33760 gi|127513899|ref|YP_001095096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]