SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_1398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_1398
Domain Number 1 Region: 46-114
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000484
Family Collagen-binding domain 0.012
Further Details:      
 
Weak hits

Sequence:  324602.Caur_1398
Domain Number - Region: 407-487
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00187
Family AAT-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_1398
Sequence length 1181
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MQRLLFALVCFALLVAPMALDMRPQPATAASPSPVRLTEITNLPEIAEIEPNNRITPPGV
SAQQIASGRTDSWRQPITGVITSSIDIDYFYFDISAPGSLVTIELTNLTADYDLVFGGGV
DPATGQGGATNTFEFDAGQSGLEDVTQIGGQIASIGGQIASIGGQIASIGGQIASIGGQI
ASIGGQIASIGGQIASISVNPGNNDEQIEIIVWQPGRYFVAVAPSNAGETSSQPYRLTIT
LERSTLQSLGPAPHVQFLTDRPDPDVTTLYIINSARMQGVYPGELTAINAITTTLSSSTG
YSGLTQLVWGESENALILEKGAVIDLANLEVITGTLPFSQLLNDWSQPANQSNPLYANYL
AQIIDHVIEAAIAPAGNGLSRDVRVRYRMRANNDSNLGNETNQTTPYPNVRNIVLVGGDE
IIPFFRLPDLTTIANEADYLDYLKTIDPNTNGASLISPNNPLGAALRNRMLLSDNPYGAD
RPYRFYGFPLFVPRLAVGRIVERPSEIADFLRRNAPGFGEENIYLRDDFYYPRSLSITGY
DFLIDGANAISRTLQQATSISVTKRVLNNNTWNRAQFEAEWLEQPLDTPGFFSSPLEFYS
DTQTLVSSLNAHFDHWQLIPAVSGSGNPNFPADRILSVGYSSGFPSAIPSSSCDFYPSIC
PGFFYNTLYYSVGCHSGYNVPYLAIDQSLGPRIDFYAADFAQAFNRHAGNWIGNTGYGYG
TLDGVDYSERLAALLTQELVRNEVRPDPMAENGETYVGRSIGEALVNAKLRYLRTSLGLN
AYDYKVLAITTLYGLPWKRIFVDNPLSAPVEDLNAELPAGDRTAPTPIAGSQLTRTITFT
INYDTNYLEPTRSGQRIRLDASNFTISDTFLLASTFNVTPTVTILNNNLIGMPGLPAFTY
DITALSGSDDDSERNPLVVRDIIFVGGQYNTVNNFNPTITQIVTETFEPLITTTIEPDFS
AGIGFWVPDRFFGHSRTEGDNGPRDTLISTAAQFRATDGVTGTLRTYTQLVFQVLYTDPE
AEDAEEALADQTPPVIERVRIAGQDVNLQSVSTLIEVFVSDPDNPTNPQVTLTGVYLADD
NVTWTPLTFSQDSQNPRRWTASVPRPWPDVRLIITAIDQAGNSVMYTAKGQFTPPTYQLF
LPVINRNQSALSGDDDAGGSAMGGQLYLPIVSQDAAKLVRE
Download sequence
Identical sequences A9WA67
324602.Caur_1398 480224.Chy400_1519 gi|222524792|ref|YP_002569263.1| gi|163846971|ref|YP_001635015.1| WP_012257282.1.35445 YP_001635015.1.55443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]