SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_3270 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_3270
Domain Number 1 Region: 238-505
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.49e-69
Family Thermolysin-like 0.00000268
Further Details:      
 
Domain Number 2 Region: 1262-1345
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000123
Family Collagen-binding domain 0.026
Further Details:      
 
Domain Number 3 Region: 1020-1133
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000405
Family Collagen-binding domain 0.0084
Further Details:      
 
Domain Number 4 Region: 766-849
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000536
Family Collagen-binding domain 0.031
Further Details:      
 
Domain Number 5 Region: 645-746
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000107
Family Collagen-binding domain 0.012
Further Details:      
 
Domain Number 6 Region: 518-631
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000602
Family Collagen-binding domain 0.03
Further Details:      
 
Domain Number 7 Region: 1140-1242
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000131
Family Collagen-binding domain 0.019
Further Details:      
 
Domain Number 8 Region: 1388-1492
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000275
Family Collagen-binding domain 0.015
Further Details:      
 
Domain Number 9 Region: 891-1008
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000327
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_3270
Sequence length 1774
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MRTRRVFSWLTLIIVFCWQLGLVASFSPAPVVLAAPPSERPQRVFVDEFVAPHPTLAVAL
PGAAGNDPKTVALDFLQGPGVSLVNTVSDLTWMPVRSEAVDEGVTVVRLGQYKDQIRIWG
ADLALQVAGDTVRSVSGAFIPQVSADTKPVISLDEAIKLATVALQNDPPRHDDAELAFLT
TAFAKARLDEHELVFFNPELFGLEESDTALAYRLVLTAPDDSVSATVVVDAISGKVRLSF
SNYHSGLNRVIRDAGGVSTTSGSVCYTESGPSGTPHPDCVAAFTNTGLTYNYFWSTFARD
SYNGSGATMIAVVRYGTAANAFWNGSLTAYGPGFATRDVVAHEWTHAVTQYTAGLIYNGQ
SGALNESFSDVFGAMVDSDDWLMGEDTPIGVIRSLANPPAYNQPDRVSNYVCTTSDNGGV
HINSGIPNKAAYLMAEGGTFNGRTITAIGRLATARIFYRALTGYLTSASTFTDLYNALLA
AASSLYGSSSSQYQATLNAAQAVGLNTPVPCGGSATPDSYEPDNSPATASSITVNSAAQN
HNFHIAGDQDWVTFNATSGTVYTIRTSGLQSSADTVLALFANNGSLLLTQNDDYGGSLAS
QIVWTATANAPLHVRVTNFGGRGGANTGYSLTVTSSAPTTPPDAYEPDNALSTARSITVG
GAAQRHNFHIAGDQDWVRFSATAGTTYRIETLNLGATADTVLELYNGSAVRLTYNDDYGG
TLASRIDWYAPTSGTFFVRVRHYSSAAYGTTTSYDIRVLGIPVTGDSYEPDNSQSTARPI
AVNGATQTHTFHVPGDQDWVCFNAVAGQSYVIETLNLASGNDTVLELYNSSGTLLAYNDD
YGGTLASRIGYTSPVAQQLCVKVRHYSSSAGGTHLRYDLRVVTVDSATPDSYEPDNSPSE
ARTITPGTLDAPNTTIHNFHVAGDQDWVSLTAVAGGFYRFETDSLESRADTVISLFNSSL
SLLAEDDDGGEGLASRLTWYAPSDGTYYLRVRHYNSSIGGSQTGYRLRIGAYYTPATPDA
YEPDNTLATAKPISTGGATQDHNFHAIGDQDWVYFDAVNGVEYTMLTSDLGTRADTVLEL
YSSSGSLLAFNDDYSGLASRIVWQAPATGRFYLKVRQYNGNVYGANTNYRLRISSATPDA
YEPDNTLSAARPITVNGGSQSHNFHAAGDQDWIVFGATAGYLYRIETFNLASCSDTVLEL
YNSSGTLLAFNDDGGGGWASRIDWTAPSSGNFYVKVRHYSSAAYGACTAYEVRVTSSGSV
GDSYEPDNTLATARPITVNGTAQRHNFHVAGDLDWVYFDISSGYRYNIRTFNLGSCSDTV
LELYDSSGTTRLAYDDDGGGGLASRIEFIALTNTRLNLKVRHYSASASGPCTQYDLEVTR
IAGITPDAYEPDDTSAQARLFTVNGSGQNRNFHTPTDLDWVVFGATAGTTYTIYTYNLGA
EADTVLELYRSDGTMIAYNDDGGGGWASRIVWTASATGSYFVKIRPYGSTGGRPTSTYSF
RIITGTTLSNEDEAGHALTPLVTTQNEEVSGNRLRVVDVTVDTTPRPGQEFTTVIRAVGS
AESVKLVITPKSSLVDLLAIEPLAADGQPLAENGWLAQELSTGDLVIMTAWSADQPTDFV
RLRWRLRATLDEKLLVLPVQVLATDGSGDFWQSQVAVAVPTVAGAAKIDEVSPTFVTISS
TATLSIRVSGLNGELPKAYLVDMNGQNEQQFAAISYAPGSDDTLIASFDPSFKSGFYKVR
LDLADGSQVFSEVIVRLLSPGERVYNVYVPTTLR
Download sequence
Identical sequences A9WIZ9
gi|163848803|ref|YP_001636847.1| gi|222526756|ref|YP_002571227.1| WP_012259111.1.35445 YP_001636847.1.55443 324602.Caur_3270 480224.Chy400_3530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]