SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326297.Sama_2185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326297.Sama_2185
Domain Number 1 Region: 131-557
Classification Level Classification E-value
Superfamily Subtilisin-like 8.91e-105
Family Subtilases 0.00000000000332
Further Details:      
 
Domain Number 2 Region: 691-802
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-22
Family Proprotein convertase P-domain 0.022
Further Details:      
 
Domain Number 3 Region: 42-128
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000181
Family Subtilase propeptides/inhibitors 0.0069
Further Details:      
 
Domain Number 4 Region: 597-667
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000654
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326297.Sama_2185
Sequence length 803
Comment (Shewanella amazonensis SB2B)
Sequence
MTMKHKKTLALGLSTLALAVSAGVHAAPTDAVFAKGENSPLPKRYVVKFKNNAATELYNA
EDTLNSMQYQPRSHEVYGHHRALNAASAKEMKRIGRSNAYTVKLDNNGIKALRARADVEF
VEEDVPRRLLAETTPWGQTFVGATQLADNLSGNRTICIIDSGYDRGHADLSGNNVTGTNN
SGTGNWFEPGNNNAHGTHVAGTIAAIANGEGVVGVLPNQNANIHIIKVFNEAGWGYSSSL
VSAVDTCVANGANVVSMSLGGASSSTTERNALAAHYNNGVLLIAAAGNDGDNTHSYPASY
DSVVSVAAVDSTKQHAAFSQYTNQVEVSGPGEAILSTVTRGEGRLSDIVVAGQSYFNNGV
VPHNRLVKSGTSYAPAPINGTVTATLAECSVSGSTFNCGNMAGKVCLVERVGNQGSSYPE
INAAKACQNAGASATIVYSNTALPGLQNPFVVDTNSELTKVSVSVDRATGLALRSHIGSS
VTVSSEGGKDYEYYNGTSMATPHVSGVATLVWSYHPECSAAQVRAALRTTAEDLDVAGRD
DKTGYGLVDAVAAKEYLDASCDGPTNGGGNNGGSDAEMTNGVAKSNLAGAKNEELHFFID
VPAGATNLNFAMSGGSGDADLYVQYGAAPTTSSYDCRPWKGGNTESCPITTAQAGTYYVM
VQGYSAFSGVNLVASYTAPTGGSTGGTTGPATYTNTDNYSIPDNNTAGISSPIDVSRTGD
AGTVTVKVNIVHTYIGDLQVELITPSGQVAVLHDNTGAGTDNINKTYTVNATGVESQGTW
KLKAVDSSRRDTGYIDSWEISFQ
Download sequence
Identical sequences A1S7N4
326297.Sama_2185 gi|119775320|ref|YP_928060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]