SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL0375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326424.FRAAL0375
Domain Number 1 Region: 90-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-22
Family GntR ligand-binding domain-like 0.0048
Further Details:      
 
Domain Number 2 Region: 19-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.47e-16
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL0375
Sequence length 235
Comment (Frankia alni ACN14a)
Sequence
MRVPRPPTAWVATLSTSWSGSAREAILRELKRVILDGAAAPGLPIPVDEVAARYQVSRIP
VREALMSLVGEGLVEHRSRAGYTVATLTPGELREFYLVREALEAAALGAAVRRATAADDA
LVSQAHAATSEAIRAGDSRGHHRESRRFHLALVNAGGMPRLARMFESAWNMTEPARPMDY
ASRDAVDLLNDDHERMLHAFRARDAAALLEVSRLHHGRLQNFVLALPESGELGQG
Download sequence
Identical sequences Q0RTP7
326424.FRAAL0375 WP_011601632.1.38265 gi|111219869|ref|YP_710663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]