SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 326424.FRAAL5259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  326424.FRAAL5259
Domain Number 1 Region: 114-183
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-17
Family GntR-like transcriptional regulators 0.007
Further Details:      
 
Domain Number 2 Region: 202-334
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000366
Family GntR ligand-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 326424.FRAAL5259
Sequence length 350
Comment (Frankia alni ACN14a)
Sequence
MGASATAAPRTEPSDRSAPPSGLAASDGSPAPAGAARPGRPATSTRAATPGRGSPPRKGA
AASRRGRRASTTPPDIATPPDIAPRPDIAAPARTAAPAHTAAIRIGQHVRVPKTAELVAA
HLRRQIVRGELHEGDALPPEAVLMEQFGVSRPTLREAFRVLESEALISVRRGAHGGARVH
TPNGHVAARYTALVLEHQHTTLADIHTAHTHLEPAAIRLLATTATDTHLTHLTTHLTTTD
HALATPHPNPTDIHTHHLNFHTLLLTTPANHTLTMISSMLRHILDATTPTPDTPTPDLTT
LRHQHTTHHQLLTHLTNHDPDAAETLWRHHLTTTPHTPHQPTTPLDLLGD
Download sequence
Identical sequences Q0RF58
gi|111224630|ref|YP_715424.1| 326424.FRAAL5259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]