SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_0649 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_0649
Domain Number 1 Region: 125-216
Classification Level Classification E-value
Superfamily S13-like H2TH domain 9.03e-20
Family Middle domain of MutM-like DNA repair proteins 0.00098
Further Details:      
 
Domain Number 2 Region: 2-127
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.79e-17
Family N-terminal domain of MutM-like DNA repair proteins 0.0000228
Further Details:      
 
Domain Number 3 Region: 236-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000913
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_0649
Sequence length 273
Comment (Acaryochloris marina MBIC11017)
Sequence
MPEGPEIRRAADRIASEIANQPLQEVWFAFSHLKIYEAQLGASQIQQVETRGKGLLMHFD
CGLSIYSHNQLYGKWMIRKAYNYPQTKRQLRLALHCDRKSALLYSASDIDVLDAAGIQAH
PFLSRIGPDVLSSETTVEQVRERLSCDRFRRRRLTTLLLDQHFLAGLGNYLRSEILFVAR
VHPSLRPADCTDEQIEKLAEAALALPRQSYETGGITNDIAWAAKLKFQGFARRVYRHWVF
ARAGQLCWVCATPIVKDAQGGRRYYYCPQCQEE
Download sequence
Identical sequences B0CE64
WP_012161293.1.67183 329726.AM1_0649 gi|158333840|ref|YP_001515012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]