SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_4367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_4367
Domain Number 1 Region: 7-234
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.61e-65
Family Decarboxylase 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_4367
Sequence length 240
Comment (Acaryochloris marina MBIC11017)
Sequence
MTTEIAQRIIVPLDVPSEADAIALIDQIPQVQFWKVGLELFVSCGPSILEQLKQRQKKVF
LDLKFHDIPNTVAGACRSAATYGVDLLTIHATAGRPALSAAQQALQEGAQSAQTAPPKLI
AITVLTSLSLRELALDLKIPLELPEYALQMGLLAQESGLNGIVCSPHEAEQMRQVCGDEF
LIVCPGVRPPGSVTGDQKRAMTPTAAMQAGANYLVIGRPITTATDPQQAFQQICTDLVSA
Download sequence
Identical sequences B0CEU9
WP_012164671.1.67183 gi|158337488|ref|YP_001518663.1| 329726.AM1_4367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]