SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_5905 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_5905
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.24e-62
Family AAT-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_5905
Sequence length 367
Comment (Acaryochloris marina MBIC11017)
Sequence
MSRPLHGGNLRWAADIAGCSPNCILDFSASINPLGPPESAISAIQTHLDTLTAYPDPSYQ
SICQVLSEVHQLPVDWFLPGNGSAELLTWACRDLAQLAWTGVLKPAFADYQRALKAFQAQ
IRPLPLNLRQIQHQSSSELIEQALQIARQSADSAQAGLLLNNPHNPTGGLISIHQIEPFL
EQFPLVVVDEAFMDFLPVDADYSLISKVQDFPNLVILRSLTKFYSLPGLRLGYAIGHPDQ
LRPWQQCRDPWSVNSLAVMAGIAVLGDRAFQNKTLSWLPPVRTELMQGLVALGAYPLEGA
ANFLLVQTKVSVPLLQELLLKHHRILIRDCLSFPELGDQYFRIAVRTQADNQRLLTALAD
CLPRLSV
Download sequence
Identical sequences B0C1L0
WP_012166050.1.67183 gi|158338986|ref|YP_001520163.1| 329726.AM1_5905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]