SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_5920 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_5920
Domain Number 1 Region: 231-426
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-46
Family Ribonuclease PH domain 1-like 0.00000571
Further Details:      
 
Domain Number 2 Region: 73-162
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.67e-27
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 3 Region: 389-487
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.17e-27
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 494-579
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.13e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 5 Region: 1-72
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-20
Family Ribonuclease PH domain 1-like 0.00024
Further Details:      
 
Domain Number 6 Region: 554-629
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-17
Family Cold shock DNA-binding domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_5920
Sequence length 646
Comment (Acaryochloris marina MBIC11017)
Sequence
MPGGFLRREGRPPEKATLTCRLIDRPMRPLFPNWLRDDLQIVATTISMDEQVPPDVLAVT
GASVATLLAKIPFKGPMAAVRVGLVGDDFIINPTYEEISEGELDLVVAGSPDGVIMVEAG
ANEVAEQDMIEAIDFGYEVVCDLIKAQKELIAELGIEQVEEAAPETDPTLENFVQERVTD
PVKDVLARFEKDKNVRDAALDEIKESVKVAIDELPETDPVQVAAVENPKAIGKVFKSITK
TLMRRQVVEDKVRVDGRKLDEVRPISCNVGVLPQRVHGSGLFNRGLTQVLSIATLGTPGD
AQEMDDLHPDSQKRYLHHYNFPPYSVGETRPMRSPGRREVGHGALAERALLPMLPSKEEF
PYVLRVVSEVLSSNGSTSMGSVCGSTLSLMDAGVPLAKPVSGAAMGLIKEGEEVRVLTDI
QGIEDFLGDMDFKVAGTADGITALQMDMKITGLSMKVIAEAIHQAKPARLHILDKMLATI
DSPRETMSPYAPRLLTIKIDPEQIGMIIGPGGKTIKGITEETGAKIDIEDDGRVTISAVD
EKAASRARQIIAGMTRKLAAGDVFLGKVTRIIPIGAFVEIAPSKEGMIHISQLADYRVGK
VEDEVTVGDEVVVKIRELDNRGRINLTRLGIHPEEAAAARAGGSES
Download sequence
Identical sequences gi|158339001|ref|YP_001520178.1| 329726.AM1_5920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]