SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 329726.AM1_5959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  329726.AM1_5959
Domain Number 1 Region: 5-293
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.92e-73
Family AstE/AspA-like 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 329726.AM1_5959
Sequence length 295
Comment (Acaryochloris marina MBIC11017)
Sequence
MNTNHIRQVVIVGGTHGNERIGLYLVKKFNQDSSLLFRPNLTTNCLIGNPQACKENQRYI
ETDLNRCFIKADLDNHLLGRHEEKQAKVLHEQLGPKGNSENFLLDLHSTTANMGLTLILV
NDHPFNLHLAAYLTHHNPQVRVYRWTQENQENAFVSSLCQLGFAIEVGPIPQGILLASLF
KETETLIHQTLDYLEQVNRGASPPLPKTLTLFQHLEVVDYPKTSNGELAGMIHPQLQGRD
YQPLNPGDPIFLTFEDQTLFYEGCSTVWPIFINEAAYYEKGIAMCLTHKQDISLK
Download sequence
Identical sequences B0C2K7
WP_012166097.1.67183 gi|158339037|ref|YP_001520214.1| 329726.AM1_5959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]